Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G152000.1
Common NamePOPTR_0014s15010g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 763aa    MW: 83224.4 Da    PI: 5.6446
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G152000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
                         688999***********************************************999 PP

               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++elv++a+ +ep+W+ s       +++de++++f+++ +     ++ ea+r+s+vv+m++ +lve l+d++ qW++ +     +
                         57899********************99888899**********999********************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlev+s+g      galq+m+ae+q+++plvp R+++fvRy++q+ +g+w++vdvS+d+ ++ p    ++R++++pSg+li+++ ng+s
                         ****************************************************************99....6******************** PP

               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.95792152IPR001356Homeobox domain
SMARTSM003894.8E-2093156IPR001356Homeobox domain
PfamPF000464.3E-1895150IPR001356Homeobox domain
CDDcd000862.71E-1995153No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
SuperFamilySSF559612.31E-34275506No hitNo description
PROSITE profilePS5084843.814275507IPR002913START domain
CDDcd088751.06E-128279503No hitNo description
SMARTSM002344.7E-66284504IPR002913START domain
PfamPF018529.9E-58285504IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-4380485IPR023393START-like domain
SuperFamilySSF559612.43E-23523754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320458.20.0hypothetical protein POPTR_0014s15010g
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLB9IAE60.0B9IAE6_POPTR; Uncharacterized protein
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2